Pós esteroides da fabricação profissional, líquido esteroide da injeção, Peptides, HGH176-191, Sarms, matérias primas farmacêuticas (Phenacetin), GBL, anestésicos locais, BB, VAGABUNDOS etc.

Casa Produtospeptides da hormona de crescimento

CAS 863288-34-0 Peptides do body building CJC-1295 para a produção do GH do aumento

Certificado
de boa qualidade esteróides anabólicos androgénicos para vendas
de boa qualidade esteróides anabólicos androgénicos para vendas
É uma experiência unforgetable. Eu era surpresa sobre o pacote discreto e entrega rápida quando eu peço na primeira vez!

—— Aitor Parazation-Países Baixos

O costume da passagem da segurança, o pacote agradável e a qualidade super são meu melhor favoráveis. Sim, podem fazê-la e fizeram aquele. Eu estou tão feliz…

—— Michael Decapvcca-Reino Unido

Mim COM Eric dos negócios do fazer, clientes do seus do por do responsável do sempre do é do ele. Apuros do em do cheguei de Quando, iria do ele mim ajudar um resolvê-los. melhor sentir-SE

—— PRISCILLA DE OLIVEIRA-Brasil

Estou Chat Online Agora

CAS 863288-34-0 Peptides do body building CJC-1295 para a produção do GH do aumento

China CAS 863288-34-0 Peptides do body building CJC-1295 para a produção do GH do aumento fornecedor

Imagem Grande :  CAS 863288-34-0 Peptides do body building CJC-1295 para a produção do GH do aumento

Detalhes do produto:

Lugar de origem: Made in China
Marca: NJBN STEROID
Certificação: ISO9001 , SGS , KOSHER
Número do modelo: 863288-34-0

Condições de Pagamento e Envio:

Quantidade de ordem mínima: 10 G
Preço: Negotiation
Detalhes da embalagem: 2mg/vial, 10vials/kit, 1g/bag
Tempo de entrega: 4~6 dias de trabalho após o pagamento pelo correio expresso
Termos de pagamento: União ocidental, Moneygram, T/T & Bitcoin
Habilidade da fonte: 1500kg/Month
Descrição de produto detalhada
Uso: Aumente a produção do GH CAS: 863288-34-0
mercado: Global Aparência: pó branco
Quantidade de ordem mínima: 10 G Amostra: livre

Peptides quentes CAS do body building da venda 863288-34-0 CJC-1295 para a produção do GH do aumento

 

Detalhe rápido:

 

Nome do produto CJC1295
Sinônimos CJC1295; Y (d - A) DAIFTQSYRKVLAQLSARKLLQDILSR-NH2; L-Tyrosyl-D-alanyl-L-alpha-aspartyl-L-alanyl-L-isoleucyl-L-phenylalanyl-L-threonyl-L-glutaminyl-L-seryl-L-tyrosyl-L-arginyl-L-lysyl-L-valyl-L-leucyl-L-alanyl-L-glutaminyl-L-seryl-L-alanyl-L-arginyl-L-lysyl-L-leucyl-L-leucyl-L-glutaminyl-L-alpha-aspartyl-L-isoleucyl-L-leucyl-L-seryl-L-arginyl-N6- [3 (2,5-dihydro-2,5-dioxo-1H-pyrrol-1-yl) - 1-oxopropyl] - L-lysinamide; Acetato CJC-1295; CJC1295 com para fora o DAC
Número do registro de CAS 863288-34-0
Fórmula molecular C159H258N46O45
Categorias de produto Peptides
Ensaio 99%
Aparência pó branco
Uso Aumente a produção do GH
Quantidade de ordem mínima 10g
Envio Pelo correio expresso
Prazo de execução de envio Dentro de 24 horas após ter recebido o pagamento
Opções do pagamento Western Union, MoneyGram, T/T, Bitcoin
Preço Negociado

 

Descrição:

 

1.by Bill RobertsCJC-1295 é um peptide injetável usado para aumentar a produção do GH. Este peptide é uma hormona de crescimento que liberam a hormona (GHRH) mimetic, ou analógico. Aquele é dizer, trabalha da mesma forma como GHRH, e pode ser referido como ser um uso principal de GHRH.The de CJC-1295 é fornecer níveis aumentados do GH, que igualmente conduz a IGF-1levels aumentado. Um aumento nestes níveis pode ajudar à perda gorda e em alguns casos pode ajudar ao ganho do músculo também. Geralmente, um produto na categoria de GHRH, incluindo CJC-1295, é escolhido como uma substituição a usar o GH, e somente raramente combinado com o GH.

 

o outro GHRH produto principal de 2.The é a modificação GRF 1-29, quena maioriadeexemploseurecomendosobreCJC-1295. Osprodutosdiferememsuaduraçãodaação. AmodificaçãoGRFtemumaduraçãocurtoaproximado-idealdaaçãopermitindoadosepulsatile, visto queCJC-1295temumaduraçãoprolongadadaaçãoqueimpedetaldose. ÉimportanteevitarconfundirCJC-1295como“CJC-1295 sem DAC.” O último não é CJC-1295, mas é um pouco a modificação misnamed GRF. Quando um peptide não tem DAC, não é CJC-1295.CJC 1295 está introduzido no mercado às vezes como “CJC-1295 com DAC.” Este é simplesmente CJC-1295.

 

Quando usar CJC-1295

 

o produto 1.This é serido mais aos exemplos onde um indivíduo deseja injetar raramente e está procurando o apoio substantivo para a produção do GH um pouco do que um aumento do máximo ou do próximo-máximo. Isto é porque os níveis que de sangue lisos fornece não combinam acima bem com a dose pulsatile, que é precisada para o grande efeito. Os níveis constantes podem fornecer o apoio muito bom para pulsos naturais do GH, contudo.

 

2.Relatively raramente, os efeitos secundários adversos associados com o uso excessivo do GH, tal como a dor da compressão do nervo (tal como a dor do túnel do carpal), retenção excessiva da água, ou sensibilidade reduzida da insulina podem ocorrer do uso CJC-1295. A causa é estimulação de uma quantidade maior de produção do GH do que é apropriado para o caso individual. A solução é interromper o uso até que o problema esteja resolved, e reduzir a dosagem ao recomeçar apoio em curso de use.for da produção do GH, nas doses recomendadas abaixo, CJC-1295 não precisa de ser dada um ciclo.

 

Como usar CJC-1295

 

1.CJC 1295 é fornecido tipicamente em uns tubos de ensaio que contêm magnésio 2 ou 5 do pó lyophylized, embora a quantidade pode variar. Os índices devem ser reconstituídos adicionando uma quantidade conveniente de água estéril ou bacteriostatic. Se por exemplo 2 mL são escolhidos e a dose do tubo de ensaio é magnésio 2, a solução resultante a seguir tem uma concentração de 1 mg/mL, ou 1000 mcg/mL.


a época 2.At da dose, uma seringa da insulina é usada para tirar e injetar então a quantidade desejada. No exemplo acima, uma dose 1000 do magnetocardiograma exigiria um volume de 1 mL, ou “100 IU” como marcados em uma seringa da insulina.

A injeção pode ser subcutâneo, intramuscular, ou intravenous de acordo com a preferência pessoal. Se desejadas, as soluções do peptide de outros tubos de ensaio, tais como um tubo de ensaio de um produto de GHRP, podem igualmente ser tiradas na mesma seringa, se há uma sala. Isto reduz o número total das injeções required.when que recomendam CJC 1295, eu recomendo ordinariamente uma dosagem do magnetocardiograma 1000 em um momento, duas vezes pela semana.

 

Aplicação: 

 

1.CJC-1295 atua durante mais tempo do que GRF puro. Atua na glândula pituitária e mantém-se estimular a liberação da hormona de crescimento nos pulsos. A razão pela qual atua nos pulsos é porque a linha central da hormona de crescimento humano controla quanto da hormona pode permanecer no corpo em um momento. Isto mantém o ambiente homeostático no corpo.

 

a tecnologia de 2.The DAC no CJC-1295 permite o composto de ligar-se covalently com toda a albumina de circulação, depois que foi administrada através de uma injeção subcutâneo. Contudo, a razão pela qual a meia-vida poderia ser prolongada de alguns minutos a diversos dias é mais profunda. O grupo reativo no CJC-1295 liga a um peptide com o bioconjugation. O peptide então encontra uma unidade neucleophilic dentro do sangue e reage com ele a fim criar uma ligação mais firme.

 

3.When usando todo o GHRH, deve-se sempre recordar que os resultados positivos não podem ser conseguidos durante a noite. Estes compostos atuam firmemente ao longo do tempo, e os melhores resultados podem ser conseguidos lentamente, e com uma dieta nutritivo e um regime apropriado do exercício. Também, estes peptides não são sexo-específicos, assim que não têm nenhuns efeitos androgênicos. Podem ser usados por mulheres nas mesmas dosagens que os homens fazem.

 

Porque você nos escolhe:

 

  • De alta qualidade com preço competitivo

Nós somos fabricante e podemos fornecer os produtos de alta qualidade o preço competitivo, oferecendo as amostras grátis as mais totest, alguns taxa do transporte somente.

 

  • Termo flexível do pagamento

Nós aceitamos cada termo do pagamento, tal como T/T, Bitcoin, Moneygram, Western Union.

 

  • Entrega rápida e segura

 

1)O pacote pode ser mandado em 24 horas após ter comfirming o pagamento.
2) Vários métodos do transporte para sua escolha, tal como o EMS, Fedex, TNT, DHL, USP.
3) Nós temos nosso próprio agente que pode nos ajudar a enviar fastly e com segurança nossos produtos, e nós temos bastante estoque dentro lá transferindo.
4)Nós temos a maneira especial poderíamos enviar 10g aos produtos sveral do quilograma um momento. Nós oferecemos o pó de derretimento no serviço líquido. E envie o líquido em maneiras especiais do pacote.
5)Ofereça o número de referência o mais atrasado para você à verificação.

 

  • Nós temos clientes no mundo inteiro

 

1)O serviço profissional e a experiência rica fazem clientes sentir confortáveis e confiar-nos.
2)Estoque adequado (tal como anti esteroides da hormona estrogênica) e reunião rápida da entrega sua procura.
3)O feedback do mercado e o feedback dos produtos serão apreciados, cumprindo a exigência de clientes são nossa responsabilidade.
4) Ganho de alta qualidade e do preço competitivo a confiança e o elogio dos clientes em todo o mundo.

 

  • Bom serviço pós-venda

 

1)Diga a atualização do pacote O MAIS CEDO POSSÍVEL, e tentará o melhor resolvem quando o cliente encontrou vários problemas.
2)Nós ensiná-lo-emos que as receitas e as instruções para todo o tipo do esteroide para transformar o pó no líquido, e o líquido se transformam as estéreis.

 

Informação de contato:

Skype: teresa556678

Pessoa de contato: Teresa

E-mail: teresa@chembj.com

Whatsapp: +8617327095740

Web site: www.realanabolicsteroids.com

 

CAS 863288-34-0 Peptides do body building CJC-1295 para a produção do GH do aumento

 

Contacto
Nanjing Bangnuo Biotechnology Co., Ltd

Pessoa de Contato: CPSS

Telefone: +8617327093119

Envie sua pergunta diretamente para nós (0 / 3000)